Lineage for d1qtys_ (1qty S:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749103Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 749104Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 749105Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 749117Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 749120Species Human (Homo sapiens) [TaxId:9606] [57506] (15 PDB entries)
  8. 749147Domain d1qtys_: 1qty S: [44774]
    Other proteins in same PDB: d1qtyt_, d1qtyu_, d1qtyx_, d1qtyy_

Details for d1qtys_

PDB Entry: 1qty (more details), 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor
PDB Compounds: (S:) vascular endothelial growth factor

SCOP Domain Sequences for d1qtys_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtys_ g.17.1.1 (S:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOP Domain Coordinates for d1qtys_:

Click to download the PDB-style file with coordinates for d1qtys_.
(The format of our PDB-style files is described here.)

Timeline for d1qtys_: