SCOP 1.63: Domain d1qtys_: 1qty S:

Lineage for d1qtys_ (1qty S:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulphide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (11 PDB entries)

8. Domain d1qtys_: 1qty S: [44774]
   Other proteins in same PDB: d1qtyt_, d1qtyu_, d1qtyx_, d1qtyy_

Details for d1qtys_

PDB Entry: 1qty, 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1qtys_:

Sequence; same for both SEQRES and ATOM records:

>d1qtys_ g.17.1.1 (S:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

Timeline for d1qtys_:

• d1qtys_ first appeared (with stable ids) in SCOP 1.55
  
• d1qtys_ appears in SCOP 1.61
  
• d1qtys_ appears in SCOP 1.65
  
• d1qtys_ appears in the current release, SCOPe 2.08