Lineage for d1qtyw_ (1qty W:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963384Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1963385Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1963386Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1963398Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1963401Species Human (Homo sapiens) [TaxId:9606] [57506] (17 PDB entries)
    Uniprot P15692 40-133
  8. 1963430Domain d1qtyw_: 1qty W: [44772]
    Other proteins in same PDB: d1qtyt_, d1qtyu_, d1qtyx_, d1qtyy_

Details for d1qtyw_

PDB Entry: 1qty (more details), 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor
PDB Compounds: (W:) vascular endothelial growth factor

SCOPe Domain Sequences for d1qtyw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtyw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOPe Domain Coordinates for d1qtyw_:

Click to download the PDB-style file with coordinates for d1qtyw_.
(The format of our PDB-style files is described here.)

Timeline for d1qtyw_: