Class g: Small proteins [56992] (98 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries) Uniprot P15692 40-133 |
Domain d1bj1v_: 1bj1 V: [44763] Other proteins in same PDB: d1bj1h1, d1bj1h2, d1bj1j1, d1bj1j2, d1bj1k1, d1bj1k2, d1bj1l1, d1bj1l2 complexed with so4 |
PDB Entry: 1bj1 (more details), 2.4 Å
SCOPe Domain Sequences for d1bj1v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bj1v_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]} vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee snitmqimrikphqgqhigemsflqhnkcecrpk
Timeline for d1bj1v_: