Lineage for d2vpfg_ (2vpf G:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063985Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1063986Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1063987Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1063999Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1064002Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
    Uniprot P15692 40-133
  8. 1064013Domain d2vpfg_: 2vpf G: [44761]

Details for d2vpfg_

PDB Entry: 2vpf (more details), 1.93 Å

PDB Description: vascular endothelial growth factor refined to 1.93 angstroms resolution
PDB Compounds: (G:) vascular endothelial growth factor

SCOPe Domain Sequences for d2vpfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpfg_ g.17.1.1 (G:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOPe Domain Coordinates for d2vpfg_:

Click to download the PDB-style file with coordinates for d2vpfg_.
(The format of our PDB-style files is described here.)

Timeline for d2vpfg_: