Lineage for d2vpfc_ (2vpf C:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703391Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1703392Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1703393Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1703405Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1703408Species Human (Homo sapiens) [TaxId:9606] [57506] (16 PDB entries)
    Uniprot P15692 40-133
  8. 1703415Domain d2vpfc_: 2vpf C: [44757]

Details for d2vpfc_

PDB Entry: 2vpf (more details), 1.93 Å

PDB Description: vascular endothelial growth factor refined to 1.93 angstroms resolution
PDB Compounds: (C:) vascular endothelial growth factor

SCOPe Domain Sequences for d2vpfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpfc_ g.17.1.1 (C:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkcecrp

SCOPe Domain Coordinates for d2vpfc_:

Click to download the PDB-style file with coordinates for d2vpfc_.
(The format of our PDB-style files is described here.)

Timeline for d2vpfc_: