SCOP 1.69: Domain d2vpfb_: 2vpf B:

Lineage for d2vpfb_ (2vpf B:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (13 PDB entries)

8. Domain d2vpfb_: 2vpf B: [44756]

Details for d2vpfb_

PDB Entry: 2vpf, 1.93 Å

PDB Description: vascular endothelial growth factor refined to 1.93 angstroms resolution

SCOP Domain Sequences for d2vpfb_:

Sequence; same for both SEQRES and ATOM records:

>d2vpfb_ g.17.1.1 (B:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

Timeline for d2vpfb_:

• d2vpfb_ first appeared (with stable ids) in SCOP 1.55
  
• d2vpfb_ appears in SCOP 1.67
  
• d2vpfb_ appears in SCOP 1.71
  
• d2vpfb_ appears in the current release, SCOPe 2.08