Lineage for d1vppw_ (1vpp W:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963384Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1963385Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1963386Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1963398Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1963401Species Human (Homo sapiens) [TaxId:9606] [57506] (17 PDB entries)
    Uniprot P15692 40-133
  8. 1963405Domain d1vppw_: 1vpp W: [44754]

Details for d1vppw_

PDB Entry: 1vpp (more details), 1.9 Å

PDB Description: complex between vegf and a receptor blocking peptide
PDB Compounds: (W:) protein (vascular endothelial growth factor)

SCOPe Domain Sequences for d1vppw_:

Sequence, based on SEQRES records: (download)

>d1vppw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

Sequence, based on observed residues (ATOM records): (download)

>d1vppw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifieyifkpscvplmrcggccndeglecvpteesnitm
qimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d1vppw_:

Click to download the PDB-style file with coordinates for d1vppw_.
(The format of our PDB-style files is described here.)

Timeline for d1vppw_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vppv_