SCOP 1.73: Domain d1fltw_: 1flt W:

Lineage for d1fltw_ (1flt W:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (15 PDB entries)

8. Domain d1fltw_: 1flt W: [44752]
   Other proteins in same PDB: d1fltx_, d1flty_

Details for d1fltw_

PDB Entry: 1flt, 1.7 Å

PDB Description: vegf in complex with domain 2 of the flt-1 receptor

PDB Compounds: (W:) vascular endothelial growth factor

SCOP Domain Sequences for d1fltw_:

Sequence; same for both SEQRES and ATOM records:

>d1fltw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrpkkd

Timeline for d1fltw_:

• d1fltw_ first appeared (with stable ids) in SCOP 1.55
  
• d1fltw_ appears in SCOP 1.71
  
• d1fltw_ appears in SCOP 1.75
  
• d1fltw_ appears in the current release, SCOPe 2.08