SCOP 1.63: Domain d1fltv_: 1flt V:

Lineage for d1fltv_ (1flt V:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulphide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (11 PDB entries)

8. Domain d1fltv_: 1flt V: [44751]
   Other proteins in same PDB: d1fltx_, d1flty_

Details for d1fltv_

PDB Entry: 1flt, 1.7 Å

PDB Description: vegf in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1fltv_:

Sequence; same for both SEQRES and ATOM records:

>d1fltv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

Timeline for d1fltv_:

• d1fltv_ first appeared (with stable ids) in SCOP 1.55
  
• d1fltv_ appears in SCOP 1.61
  
• d1fltv_ appears in SCOP 1.65
  
• d1fltv_ appears in the current release, SCOPe 2.08