Lineage for d1fltv_ (1flt V:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89754Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 89755Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) (S)
  5. 89756Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 89766Protein Vascular endothelial growth factor, VEGF [57505] (1 species)
  7. 89767Species Human (Homo sapiens) [TaxId:9606] [57506] (7 PDB entries)
  8. 89768Domain d1fltv_: 1flt V: [44751]
    Other proteins in same PDB: d1fltx_, d1flty_

Details for d1fltv_

PDB Entry: 1flt (more details), 1.7 Å

PDB Description: vegf in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1fltv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fltv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOP Domain Coordinates for d1fltv_:

Click to download the PDB-style file with coordinates for d1fltv_.
(The format of our PDB-style files is described here.)

Timeline for d1fltv_: