![]() | Class g: Small proteins [56992] (59 folds) |
![]() | Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily) |
![]() | Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) ![]() |
![]() | Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins) |
![]() | Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries) |
![]() | Domain d1bmob3: 1bmo B:78-135 [44718] Other proteins in same PDB: d1bmoa1, d1bmoa2, d1bmob1, d1bmob2 |
PDB Entry: 1bmo (more details), 3.1 Å
SCOP Domain Sequences for d1bmob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmob3 g.15.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)} cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi
Timeline for d1bmob3: