SCOP 1.59: Domain d1bmob3: 1bmo B:78-135

Lineage for d1bmob3 (1bmo B:78-135)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)

4. Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families)

5. Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)

6. Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)

8. Domain d1bmob3: 1bmo B:78-135 [44718]
   Other proteins in same PDB: d1bmoa1, d1bmoa2, d1bmob1, d1bmob2

Details for d1bmob3

PDB Entry: 1bmo, 3.1 Å

PDB Description: bm-40, fs/ec domain pair

SCOP Domain Sequences for d1bmob3:

Sequence; same for both SEQRES and ATOM records:

>d1bmob3 g.15.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

Timeline for d1bmob3:

• d1bmob3 first appeared (with stable ids) in SCOP 1.55
  
• d1bmob3 appears in SCOP 1.57
  
• d1bmob3 appears in SCOP 1.61
  
• d1bmob3 appears in the current release, SCOPe 2.08