Class g: Small proteins [56992] (100 folds) |
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) conserved core consists of a helix and a loop crosslinked with two disulfides |
Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
Protein Ovomucoid domains [57469] (3 species) unless specified in the comment, the listed structures are of domain III |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries) |
Domain d1hjai_: 1hja I: [44691] Other proteins in same PDB: d1hja.1 |
PDB Entry: 1hja (more details), 2.3 Å
SCOPe Domain Sequences for d1hjai_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjai_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} vdcseypkpactkeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc
Timeline for d1hjai_: