Lineage for d1hjai_ (1hja I:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 3038472Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 3038484Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries)
  8. 3038515Domain d1hjai_: 1hja I: [44691]
    Other proteins in same PDB: d1hja.1

Details for d1hjai_

PDB Entry: 1hja (more details), 2.3 Å

PDB Description: lys 18 variant of turkey ovomucoid inhibitor third domain complexed with alpha-chymotrypsin
PDB Compounds: (I:) ovomucoid inhibitor

SCOPe Domain Sequences for d1hjai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjai_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactkeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOPe Domain Coordinates for d1hjai_:

Click to download the PDB-style file with coordinates for d1hjai_.
(The format of our PDB-style files is described here.)

Timeline for d1hjai_: