SCOPe 2.03: Domain d2hppp_: 2hpp P:

Lineage for d2hppp_ (2hpp P:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Meizothrombin [57450] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57451] (2 PDB entries)

8. Domain d2hppp_: 2hpp P: [44654]
   Other proteins in same PDB: d2hpp.1
   complexed with 0g7

Details for d2hppp_

PDB Entry: 2hpp, 3.3 Å

PDB Description: Structures of the noncovalent complexes of human and bovine prothrombin fragment 2 with human ppack-thrombin

PDB Compounds: (P:) Prothrombin

SCOPe Domain Sequences for d2hppp_:

Sequence; same for both SEQRES and ATOM records:

>d2hppp_ g.14.1.1 (P:) Meizothrombin {Cow (Bos taurus) [TaxId: 9913]}
cvpdrgreyrgrlavttsgsrclawsseqakalskdqdfnpavplaenfcrnpdgdeega
wcyvadqpgdfeycnlnyc

Timeline for d2hppp_:

• d2hppp_ first appeared (with stable ids) in SCOP 1.55
  
• d2hppp_ appears in SCOPe 2.02
  
• d2hppp_ appears in SCOPe 2.04
  
• d2hppp_ appears in the current release, SCOPe 2.08