SCOP 1.55: Domain d1hpj__: 1hpj -

Lineage for d1hpj__ (1hpj -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (8 proteins)

6. Protein Plasminogen kringles [57446] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57447] (6 PDB entries)

8. Domain d1hpj__: 1hpj - [44649]

Details for d1hpj__

PDB Entry: 1hpj

PDB Description: solution nmr structure of the human plasminogen kringle 1 domain complexed with 6-aminohexanoic acid at ph 5.3, 310k, derived from randomly generated structures using simulated annealing, 12 structures

SCOP Domain Sequences for d1hpj__:

Sequence; same for both SEQRES and ATOM records:

>d1hpj__ g.14.1.1 (-) Plasminogen kringles {Human (Homo sapiens)}
cktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqgp
wcyttdpekrydycdilec

Timeline for d1hpj__:

• d1hpj__ appears in SCOP 1.57
  
• d1hpj__ appears in the current release, SCOPe 2.08, called d1hpja_