SCOP 1.59: Domain d1ceab_: 1cea B:

Lineage for d1ceab_ (1cea B:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Plasminogen kringle domains [57446] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57447] (6 PDB entries)

8. Domain d1ceab_: 1cea B: [44645]

Details for d1ceab_

PDB Entry: 1cea, 2.1 Å

PDB Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with eaca (epsilon-aminocaproic acid)

SCOP Domain Sequences for d1ceab_:

Sequence; same for both SEQRES and ATOM records:

>d1ceab_ g.14.1.1 (B:) Plasminogen kringle domains {Human (Homo sapiens)}
ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
pwcyttdpekrydycdilec

Timeline for d1ceab_:

• d1ceab_ first appeared (with stable ids) in SCOP 1.55
  
• d1ceab_ appears in SCOP 1.57
  
• d1ceab_ appears in SCOP 1.61
  
• d1ceab_ appears in the current release, SCOPe 2.08