Lineage for d1pk2__ (1pk2 -)
- Root: SCOP 1.61
Class g: Small proteins [56992] (59 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily) Superfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.1: Kringle modules [57441] (6 proteins) 
Protein Plasminogen [63400] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries) 
Domain d1pk2__: 1pk2 - [44641]
Details for d1pk2__
PDB Entry: 1pk2 (more details)
PDB Description: solution structure of the tissue-type plasminogen activator kringle 2 domain complexed to 6-aminohexanoic acid an antifibrinolytic drug
SCOP Domain Sequences for d1pk2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk2__ g.14.1.1 (-) Plasminogen {Human (Homo sapiens)}
segnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycr
npdgdakpwchvlknrrltweycdvpscst
SCOP Domain Coordinates for d1pk2__:
Click to download the PDB-style file with coordinates for d1pk2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pk2__:
- d1pk2__ first appeared (with stable ids) in SCOP 1.55
- d1pk2__ appears in SCOP 1.59
- d1pk2__ appears in SCOP 1.63
- d1pk2__ appears in the current release, SCOPe 2.08, called d1pk2a_
View in 3D