SCOPe 2.08: Domain d1cr8a_: 1cr8 A:

Lineage for d1cr8a_ (1cr8 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (14 PDB entries)
   Uniprot P01130 272-353

8. Domain d1cr8a_: 1cr8 A: [44613]
   complement module 8
   complexed with ca

Details for d1cr8a_

PDB Entry: 1cr8

PDB Description: low density lipoprotein receptor-related protein complement repeat 8

PDB Compounds: (A:) protein (low density lipoprotein receptor related protein)

SCOPe Domain Sequences for d1cr8a_:

Sequence; same for both SEQRES and ATOM records:

>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
pggchtdefqcrldglciplrwrcdgdtdcmdssdekscegv

Timeline for d1cr8a_:

• d1cr8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cr8a_ appears in SCOPe 2.07