Lineage for d1tapa_ (1tap A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637532Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)
  6. 2637533Protein Anticoagulant protein, factor Xa inhibitor [57389] (1 species)
  7. 2637534Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57390] (4 PDB entries)
  8. 2637538Domain d1tapa_: 1tap A: [44569]

Details for d1tapa_

PDB Entry: 1tap (more details)

PDB Description: nmr solution structure of recombinant tick anticoagulant protein (rtap), a factor xa inhibitor from the tick ornithodoros moubata
PDB Compounds: (A:) factor xa inhibitor

SCOPe Domain Sequences for d1tapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tapa_ g.8.1.2 (A:) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci

SCOPe Domain Coordinates for d1tapa_:

Click to download the PDB-style file with coordinates for d1tapa_.
(The format of our PDB-style files is described here.)

Timeline for d1tapa_: