Lineage for d1tap__ (1tap -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40392Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 40393Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 40508Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)
  6. 40509Protein Anticoagulant protein, factor Xa inhibitor [57389] (1 species)
  7. 40510Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57390] (4 PDB entries)
  8. 40514Domain d1tap__: 1tap - [44569]

Details for d1tap__

PDB Entry: 1tap (more details)

PDB Description: nmr solution structure of recombinant tick anticoagulant protein (rtap), a factor xa inhibitor from the tick ornithodoros moubata

SCOP Domain Sequences for d1tap__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tap__ g.8.1.2 (-) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata)}
ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci

SCOP Domain Coordinates for d1tap__:

Click to download the PDB-style file with coordinates for d1tap__.
(The format of our PDB-style files is described here.)

Timeline for d1tap__: