Lineage for d1tcpa_ (1tcp A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259663Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)
  6. 2259664Protein Anticoagulant protein, factor Xa inhibitor [57389] (1 species)
  7. 2259665Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57390] (4 PDB entries)
  8. 2259668Domain d1tcpa_: 1tcp A: [44568]

Details for d1tcpa_

PDB Entry: 1tcp (more details)

PDB Description: nmr structure determination of tick anticoagulant peptide (tap)
PDB Compounds: (A:) tick anticoagulant peptide

SCOPe Domain Sequences for d1tcpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcpa_ g.8.1.2 (A:) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci

SCOPe Domain Coordinates for d1tcpa_:

Click to download the PDB-style file with coordinates for d1tcpa_.
(The format of our PDB-style files is described here.)

Timeline for d1tcpa_: