SCOPe 2.03: Domain d1tocu1: 1toc U:1A-56

Lineage for d1tocu1 (1toc U:1A-56)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)

6. Protein Ornithodorin [57387] (1 species)
   duplication: consists of two BPTI-like domains

7. Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57388] (1 PDB entry)

8. Domain d1tocu1: 1toc U:1A-56 [44564]
   Other proteins in same PDB: d1toc.1, d1toc.2, d1toc.3, d1toc.4

Details for d1tocu1

PDB Entry: 1toc, 3.1 Å

PDB Description: structure of serine proteinase

PDB Compounds: (U:) ornithodorin

SCOPe Domain Sequences for d1tocu1:

Sequence; same for both SEQRES and ATOM records:

>d1tocu1 g.8.1.2 (U:1A-56) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvgged

Timeline for d1tocu1:

• d1tocu1 first appeared (with stable ids) in SCOP 1.55
  
• d1tocu1 appears in SCOPe 2.02
  
• d1tocu1 appears in SCOPe 2.04
  
• d1tocu1 appears in the current release, SCOPe 2.08