Class g: Small proteins [56992] (100 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins) |
Protein Ornithodorin [57387] (1 species) duplication: consists of two BPTI-like domains |
Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57388] (1 PDB entry) |
Domain d1tocu1: 1toc U:1A-56 [44564] Other proteins in same PDB: d1toc.1, d1toc.2, d1toc.3, d1toc.4 |
PDB Entry: 1toc (more details), 3.1 Å
SCOPe Domain Sequences for d1tocu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tocu1 g.8.1.2 (U:1A-56) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvgged
Timeline for d1tocu1: