Lineage for d1toct2 (1toc T:57-119)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40392Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 40393Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 40508Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)
  6. 40515Protein Ornithodorin [57387] (1 species)
  7. 40516Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57388] (1 PDB entry)
  8. 40522Domain d1toct2: 1toc T:57-119 [44563]
    Other proteins in same PDB: d1toc.1, d1toc.2, d1toc.3, d1toc.4

Details for d1toct2

PDB Entry: 1toc (more details), 3.1 Å

PDB Description: structure of serine proteinase

SCOP Domain Sequences for d1toct2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1toct2 g.8.1.2 (T:57-119) Ornithodorin {Soft tick (Ornithodoros moubata)}
hssemhssclgdpptscaegtdityydsdsktckvlaascpsgentfesevecqvacgap
ieg

SCOP Domain Coordinates for d1toct2:

Click to download the PDB-style file with coordinates for d1toct2.
(The format of our PDB-style files is described here.)

Timeline for d1toct2: