Lineage for d1toct1 (1toc T:1A-56)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.8: BPTI-like [57361] (1 superfamily)
disulfide-rich alpha+beta foldSuperfamily g.8.1: BPTI-like [57362] (4 families) 
Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins) 
Protein Ornithodorin [57387] (1 species)
duplication: consists of two BPTI-like domainsSpecies Soft tick (Ornithodoros moubata) [TaxId:6938] [57388] (1 PDB entry) 
Domain d1toct1: 1toc T:1A-56 [44562]
Other proteins in same PDB: d1toc.1, d1toc.2, d1toc.3, d1toc.4
Details for d1toct1
PDB Entry: 1toc (more details), 3.1 Å
PDB Description: structure of serine proteinase
PDB Compounds: (T:) ornithodorinSCOPe Domain Sequences for d1toct1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1toct1 g.8.1.2 (T:1A-56) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvgged
SCOPe Domain Coordinates for d1toct1:
Click to download the PDB-style file with coordinates for d1toct1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1toct1:
View in 3D
