Lineage for d1tocr1 (1toc R:1A-56)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637532Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)
  6. 2637539Protein Ornithodorin [57387] (1 species)
    duplication: consists of two BPTI-like domains
  7. 2637540Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57388] (1 PDB entry)
  8. 2637541Domain d1tocr1: 1toc R:1A-56 [44558]
    Other proteins in same PDB: d1toc.1, d1toc.2, d1toc.3, d1toc.4

Details for d1tocr1

PDB Entry: 1toc (more details), 3.1 Å

PDB Description: structure of serine proteinase
PDB Compounds: (R:) ornithodorin

SCOPe Domain Sequences for d1tocr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tocr1 g.8.1.2 (R:1A-56) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvgged

SCOPe Domain Coordinates for d1tocr1:

Click to download the PDB-style file with coordinates for d1tocr1.
(The format of our PDB-style files is described here.)

Timeline for d1tocr1: