Lineage for d1bf0__ (1bf0 -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89306Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 89307Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 89308Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 89327Protein Calcicludine (cac) [57384] (1 species)
  7. 89328Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57385] (1 PDB entry)
  8. 89329Domain d1bf0__: 1bf0 - [44557]

Details for d1bf0__

PDB Entry: 1bf0 (more details)

PDB Description: calcicludine (cac) from green mamba dendroaspis angusticeps, nmr, 15 structures

SCOP Domain Sequences for d1bf0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf0__ g.8.1.1 (-) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps)}
wqppwyckepvrigsckkqfssfyfkwtakkclpflfsgcggnanrfqtigecrkkclgk

SCOP Domain Coordinates for d1bf0__:

Click to download the PDB-style file with coordinates for d1bf0__.
(The format of our PDB-style files is described here.)

Timeline for d1bf0__: