SCOPe 2.07: Domain d1shpa_: 1shp A:

Lineage for d1shpa_ (1shp A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein Trypsin inhibitor [57378] (1 species)

7. Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [57379] (1 PDB entry)

8. Domain d1shpa_: 1shp A: [44553]

Details for d1shpa_

PDB Entry: 1shp

PDB Description: the nmr solution structure of a kunitz-type proteinase inhibitor from the sea anemone stichodactyla helianthus

PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d1shpa_:

Sequence; same for both SEQRES and ATOM records:

>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicra

Timeline for d1shpa_:

• d1shpa_ first appeared (with stable ids) in SCOP 1.55, called d1shp__
  
• d1shpa_ appears in SCOPe 2.06
  
• d1shpa_ appears in the current release, SCOPe 2.08