Lineage for d1bunb_ (1bun B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637284Protein beta2-bungarotoxin, neurotoxin chain [57376] (1 species)
  7. 2637285Species Many-banded krait (Bungarus multicinctus) [TaxId:8616] [57377] (1 PDB entry)
  8. 2637286Domain d1bunb_: 1bun B: [44552]
    Other proteins in same PDB: d1buna_
    complexed with na

Details for d1bunb_

PDB Entry: 1bun (more details), 2.45 Å

PDB Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action
PDB Compounds: (B:) beta2-bungarotoxin

SCOPe Domain Sequences for d1bunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]}
rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley
r

SCOPe Domain Coordinates for d1bunb_:

Click to download the PDB-style file with coordinates for d1bunb_.
(The format of our PDB-style files is described here.)

Timeline for d1bunb_: