SCOPe 2.07: Domain d1bunb_: 1bun B:

Lineage for d1bunb_ (1bun B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein beta2-bungarotoxin, neurotoxin chain [57376] (1 species)

7. Species Many-banded krait (Bungarus multicinctus) [TaxId:8616] [57377] (1 PDB entry)

8. Domain d1bunb_: 1bun B: [44552]
   Other proteins in same PDB: d1buna_
   complexed with na

Details for d1bunb_

PDB Entry: 1bun, 2.45 Å

PDB Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action

PDB Compounds: (B:) beta2-bungarotoxin

SCOPe Domain Sequences for d1bunb_:

Sequence; same for both SEQRES and ATOM records:

>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]}
rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley
r

Timeline for d1bunb_:

• d1bunb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bunb_ appears in SCOPe 2.06
  
• d1bunb_ appears in the current release, SCOPe 2.08