Lineage for d1brci_ (1brc I:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1460957Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1460958Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1460959Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1460963Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)
  7. 1460964Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries)
  8. 1460970Domain d1brci_: 1brc I: [44548]
    Other proteins in same PDB: d1brce_

Details for d1brci_

PDB Entry: 1brc (more details), 2.5 Å

PDB Description: relocating a negative charge in the binding pocket of trypsin
PDB Compounds: (I:) amyloid beta-protein precursor inhibitor domain (appi)

SCOPe Domain Sequences for d1brci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brci_ g.8.1.1 (I:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]}
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

SCOPe Domain Coordinates for d1brci_:

Click to download the PDB-style file with coordinates for d1brci_.
(The format of our PDB-style files is described here.)

Timeline for d1brci_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1brce_