Lineage for d1adz__ (1adz -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89306Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 89307Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 89308Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 89423Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 89424Species Human (Homo sapiens) [TaxId:9606] [57369] (2 PDB entries)
  8. 89427Domain d1adz__: 1adz - [44542]

Details for d1adz__

PDB Entry: 1adz (more details)

PDB Description: the solution structure of the second kunitz domain of tissue factor pathway inhibitor, nmr, 30 structures

SCOP Domain Sequences for d1adz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adz__ g.8.1.1 (-) Tissue factor pathway inhibitor {Human (Homo sapiens)}
dykddddklkpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleec
knicedgpngf

SCOP Domain Coordinates for d1adz__:

Click to download the PDB-style file with coordinates for d1adz__.
(The format of our PDB-style files is described here.)

Timeline for d1adz__: