Lineage for d1tfxd_ (1tfx D:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89306Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 89307Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 89308Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 89423Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 89424Species Human (Homo sapiens) [TaxId:9606] [57369] (2 PDB entries)
  8. 89426Domain d1tfxd_: 1tfx D: [44541]
    Other proteins in same PDB: d1tfxa_, d1tfxb_

Details for d1tfxd_

PDB Entry: 1tfx (more details), 2.6 Å

PDB Description: complex of the second kunitz domain of tissue factor pathway inhibitor with porcine trypsin

SCOP Domain Sequences for d1tfxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfxd_ g.8.1.1 (D:) Tissue factor pathway inhibitor {Human (Homo sapiens)}
kpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg

SCOP Domain Coordinates for d1tfxd_:

Click to download the PDB-style file with coordinates for d1tfxd_.
(The format of our PDB-style files is described here.)

Timeline for d1tfxd_: