Lineage for d1faki_ (1fak I:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637309Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 2637310Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 2637403Domain d1faki_: 1fak I: [44515]
    Other proteins in same PDB: d1fakh_, d1fakl1, d1fakl2, d1fakl3, d1fakt1, d1fakt2
    complexed with ca, fuc, glc; mutant

Details for d1faki_

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant
PDB Compounds: (I:) protein (5l15)

SCOPe Domain Sequences for d1faki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faki_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
apdfcleppydgpcralhlryfynakaglcqtfyyggclakrnnfesaedcmrtc

SCOPe Domain Coordinates for d1faki_:

Click to download the PDB-style file with coordinates for d1faki_.
(The format of our PDB-style files is described here.)

Timeline for d1faki_: