Lineage for d3tgji_ (3tgj I:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637309Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 2637310Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 2637390Domain d3tgji_: 3tgj I: [44507]
    Other proteins in same PDB: d3tgje_
    complexed with ca, so4

Details for d3tgji_

PDB Entry: 3tgj (more details), 2.2 Å

PDB Description: s195a trypsinogen complexed with bovine pancreatic trypsin inhibitor (bpti)
PDB Compounds: (I:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3tgji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgji_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOPe Domain Coordinates for d3tgji_:

Click to download the PDB-style file with coordinates for d3tgji_.
(The format of our PDB-style files is described here.)

Timeline for d3tgji_:

2637390
d3tgji_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3tgje_