Class g: Small proteins [56992] (85 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (2 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins) |
Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [57365] (75 PDB entries) |
Domain d3tgji_: 3tgj I: [44507] Other proteins in same PDB: d3tgje_ complexed with ca, so4; mutant |
PDB Entry: 3tgj (more details), 2.2 Å
SCOP Domain Sequences for d3tgji_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tgji_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg
Timeline for d3tgji_: