SCOP 1.59: Domain d2hexe_: 2hex E:

Lineage for d2hexe_ (2hex E:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)

4. Superfamily g.8.1: BPTI-like [57362] (2 families)

5. Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)

6. Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57365] (54 PDB entries)

8. Domain d2hexe_: 2hex E: [44506]

Details for d2hexe_

PDB Entry: 2hex, 2.1 Å

PDB Description: decamers observed in the crystals of bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d2hexe_:

Sequence; same for both SEQRES and ATOM records:

>d2hexe_ g.8.1.1 (E:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

Timeline for d2hexe_:

• d2hexe_ first appeared (with stable ids) in SCOP 1.55
  
• d2hexe_ appears in SCOP 1.57
  
• d2hexe_ appears in SCOP 1.61
  
• d2hexe_ appears in the current release, SCOPe 2.08