Lineage for d3btdi_ (3btd I:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890511Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 890512Superfamily g.8.1: BPTI-like [57362] (3 families) (S)
  5. 890513Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 890551Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 890552Species Cow (Bos taurus) [TaxId:9913] [57365] (81 PDB entries)
  8. 890609Domain d3btdi_: 3btd I: [44485]
    Other proteins in same PDB: d3btde_
    complexed with ca, so4; mutant

Details for d3btdi_

PDB Entry: 3btd (more details), 1.9 Å

PDB Description: the crystal structures of the complexes between the bovine beta- trypsin and ten p1 variants of bpti.
PDB Compounds: (I:) protein (bovine pancreatic trypsin inhibitor)

SCOP Domain Sequences for d3btdi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btdi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
dfcleppytgpcdariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOP Domain Coordinates for d3btdi_:

Click to download the PDB-style file with coordinates for d3btdi_.
(The format of our PDB-style files is described here.)

Timeline for d3btdi_: