SCOPe 2.04: Domain d1es7b_: 1es7 B:

Lineage for d1es7b_ (1es7 B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)

8. Domain d1es7b_: 1es7 B: [44465]
   Other proteins in same PDB: d1es7a_, d1es7c_

Details for d1es7b_

PDB Entry: 1es7, 2.9 Å

PDB Description: complex between bmp-2 and two bmp receptor ia ectodomains

PDB Compounds: (B:) bone morphogenetic protein receptor ia

SCOPe Domain Sequences for d1es7b_:

Sequence, based on SEQRES records:

>d1es7b_ g.7.1.3 (B:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp
kaqlrrtieccrtnlcnqylqptlpp

Sequence, based on observed residues (ATOM records):

>d1es7b_ g.7.1.3 (B:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieedettlasgcmkyegsdfqckdspkaq
lrrtieccrtnlcnqylqptlpp

Timeline for d1es7b_:

• d1es7b_ first appeared (with stable ids) in SCOP 1.55
  
• d1es7b_ appears in SCOPe 2.03
  
• d1es7b_ appears in SCOPe 2.05
  
• d1es7b_ appears in the current release, SCOPe 2.08