Lineage for d1cb9a_ (1cb9 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40290Protein Cardiotoxin II [57334] (2 species)
  7. 40291Species Central asian cobra (Naja naja oxiana) [TaxId:8657] [57336] (3 PDB entries)
  8. 40293Domain d1cb9a_: 1cb9 A: [44442]

Details for d1cb9a_

PDB Entry: 1cb9 (more details)

PDB Description: nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (major form).

SCOP Domain Sequences for d1cb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb9a_ g.7.1.1 (A:) Cardiotoxin II {Central asian cobra (Naja naja oxiana)}
lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn

SCOP Domain Coordinates for d1cb9a_:

Click to download the PDB-style file with coordinates for d1cb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1cb9a_: