Lineage for d1cre__ (1cre -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40290Protein Cardiotoxin II [57334] (2 species)
  7. 40295Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57335] (3 PDB entries)
  8. 40298Domain d1cre__: 1cre - [44440]

Details for d1cre__

PDB Entry: 1cre (more details)

PDB Description: cardiotoxin ii from taiwan cobra venom, naja naja atra: structure in solution and comparision among homologous cardiotoxins

SCOP Domain Sequences for d1cre__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cre__ g.7.1.1 (-) Cardiotoxin II {Taiwan cobra (Naja naja atra)}
lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn

SCOP Domain Coordinates for d1cre__:

Click to download the PDB-style file with coordinates for d1cre__.
(The format of our PDB-style files is described here.)

Timeline for d1cre__: