Lineage for d1lsia_ (1lsi A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259219Protein Long neurotoxin 1 (component LSIII) [57320] (1 species)
  7. 2259220Species Sea snake (Laticauda semifasciata) [TaxId:8631] [57321] (1 PDB entry)
  8. 2259221Domain d1lsia_: 1lsi A: [44422]

Details for d1lsia_

PDB Entry: 1lsi (more details)

PDB Description: lsiii (nmr, 23 structures)
PDB Compounds: (A:) lsiii

SCOPe Domain Sequences for d1lsia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsia_ g.7.1.1 (A:) Long neurotoxin 1 (component LSIII) {Sea snake (Laticauda semifasciata) [TaxId: 8631]}
recylnphdtqtcpsgqeicyvkswcnawcssrgkvlefgcaatcpsvntgteikccsad
kcntyp

SCOPe Domain Coordinates for d1lsia_:

Click to download the PDB-style file with coordinates for d1lsia_.
(The format of our PDB-style files is described here.)

Timeline for d1lsia_: