Lineage for d1lsi__ (1lsi -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40359Protein Long neurotoxin 1 (component LSIII) [57320] (1 species)
  7. 40360Species Sea snake (Laticauda semifasciata) [TaxId:8631] [57321] (1 PDB entry)
  8. 40361Domain d1lsi__: 1lsi - [44422]

Details for d1lsi__

PDB Entry: 1lsi (more details)

PDB Description: lsiii (nmr, 23 structures)

SCOP Domain Sequences for d1lsi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsi__ g.7.1.1 (-) Long neurotoxin 1 (component LSIII) {Sea snake (Laticauda semifasciata)}
recylnphdtqtcpsgqeicyvkswcnawcssrgkvlefgcaatcpsvntgteikccsad
kcntyp

SCOP Domain Coordinates for d1lsi__:

Click to download the PDB-style file with coordinates for d1lsi__.
(The format of our PDB-style files is described here.)

Timeline for d1lsi__: