SCOPe 2.05: Domain d1kxia_: 1kxi A:

Lineage for d1kxia_ (1kxi A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Cardiotoxin V [57316] (1 species)

7. Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57317] (2 PDB entries)

8. Domain d1kxia_: 1kxi A: [44417]

Details for d1kxia_

PDB Entry: 1kxi, 2.19 Å

PDB Description: structure of cytotoxin homolog precursor

PDB Compounds: (A:) cardiotoxin v

SCOPe Domain Sequences for d1kxia_:

Sequence; same for both SEQRES and ATOM records:

>d1kxia_ g.7.1.1 (A:) Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
cn

Timeline for d1kxia_:

• d1kxia_ first appeared (with stable ids) in SCOP 1.55
  
• d1kxia_ appears in SCOPe 2.04
  
• d1kxia_ appears in SCOPe 2.06
  
• d1kxia_ appears in the current release, SCOPe 2.08