Lineage for d1kxia_ (1kxi A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40308Protein Cardiotoxin V [57316] (1 species)
  7. 40309Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57317] (2 PDB entries)
  8. 40310Domain d1kxia_: 1kxi A: [44417]

Details for d1kxia_

PDB Entry: 1kxi (more details), 2.19 Å

PDB Description: structure of cytotoxin homolog precursor

SCOP Domain Sequences for d1kxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxia_ g.7.1.1 (A:) Cardiotoxin V {Taiwan cobra (Naja naja atra)}
lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
cn

SCOP Domain Coordinates for d1kxia_:

Click to download the PDB-style file with coordinates for d1kxia_.
(The format of our PDB-style files is described here.)

Timeline for d1kxia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kxib_