Lineage for d1g26a_ (1g26 A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961995Superfamily g.3.16: Granulin repeat [57277] (1 family) (S)
  5. 1961996Family g.3.16.1: Granulin repeat [57278] (2 proteins)
  6. 1961997Protein N-terminal domain of granulin-1 [57279] (2 species)
  7. 1962002Species Human (Homo sapiens) [TaxId:9606] [57281] (1 PDB entry)
  8. 1962003Domain d1g26a_: 1g26 A: [44381]

Details for d1g26a_

PDB Entry: 1g26 (more details)

PDB Description: the solution structure of a well-folded peptide based on the 31- residue amino-terminal subdomain of human granulin a
PDB Compounds: (A:) granulin a

SCOPe Domain Sequences for d1g26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g26a_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Human (Homo sapiens) [TaxId: 9606]}
vvhcdmevicpdgytccrlpsgawgccpftq

SCOPe Domain Coordinates for d1g26a_:

Click to download the PDB-style file with coordinates for d1g26a_.
(The format of our PDB-style files is described here.)

Timeline for d1g26a_: