Class g: Small proteins [56992] (54 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies) |
Superfamily g.3.16: N-terminal domain of granulin-1 [57277] (1 family) |
Family g.3.16.1: N-terminal domain of granulin-1 [57278] (1 protein) |
Protein N-terminal domain of granulin-1 [57279] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [57281] (1 PDB entry) |
Domain d1g26a_: 1g26 A: [44381] |
PDB Entry: 1g26 (more details)
SCOP Domain Sequences for d1g26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g26a_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Human (Homo sapiens)} vvhcdmevicpdgytccrlpsgawgccpftq
Timeline for d1g26a_: