Lineage for d1g26a_ (1g26 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 40221Superfamily g.3.16: N-terminal domain of granulin-1 [57277] (1 family) (S)
  5. 40222Family g.3.16.1: N-terminal domain of granulin-1 [57278] (1 protein)
  6. 40223Protein N-terminal domain of granulin-1 [57279] (2 species)
  7. 40226Species Human (Homo sapiens) [TaxId:9606] [57281] (1 PDB entry)
  8. 40227Domain d1g26a_: 1g26 A: [44381]

Details for d1g26a_

PDB Entry: 1g26 (more details)

PDB Description: the solution structure of a well-folded peptide based on the 31- residue amino-terminal subdomain of human granulin a

SCOP Domain Sequences for d1g26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g26a_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Human (Homo sapiens)}
vvhcdmevicpdgytccrlpsgawgccpftq

SCOP Domain Coordinates for d1g26a_:

Click to download the PDB-style file with coordinates for d1g26a_.
(The format of our PDB-style files is described here.)

Timeline for d1g26a_: