![]() | Class g: Small proteins [56992] (58 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) |
![]() | Superfamily g.3.16: Granulin repeat [57277] (1 family) ![]() |
![]() | Family g.3.16.1: Granulin repeat [57278] (2 proteins) |
![]() | Protein N-terminal domain of granulin-1 [57279] (2 species) |
![]() | Species Carp (Cyprinus carpio) [TaxId:7962] [57280] (1 PDB entry) |
![]() | Domain d1qgma_: 1qgm A: [44380] |
PDB Entry: 1qgm (more details)
SCOP Domain Sequences for d1qgma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgma_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Carp (Cyprinus carpio)} vihcdaaticpdgttcslspygvwycspfs
Timeline for d1qgma_: