Lineage for d1qgma_ (1qgm A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 40221Superfamily g.3.16: N-terminal domain of granulin-1 [57277] (1 family) (S)
  5. 40222Family g.3.16.1: N-terminal domain of granulin-1 [57278] (1 protein)
  6. 40223Protein N-terminal domain of granulin-1 [57279] (2 species)
  7. 40224Species Carp (Cyprinus carpio) [TaxId:7962] [57280] (1 PDB entry)
  8. 40225Domain d1qgma_: 1qgm A: [44380]

Details for d1qgma_

PDB Entry: 1qgm (more details)

PDB Description: the solution structure of a 30 residue amino-terminal domain of the carp granulin-1 protein.

SCOP Domain Sequences for d1qgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgma_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Carp (Cyprinus carpio)}
vihcdaaticpdgttcslspygvwycspfs

SCOP Domain Coordinates for d1qgma_:

Click to download the PDB-style file with coordinates for d1qgma_.
(The format of our PDB-style files is described here.)

Timeline for d1qgma_: