Lineage for d1qgma_ (1qgm A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3032051Superfamily g.3.16: Granulin repeat [57277] (1 family) (S)
  5. 3032052Family g.3.16.1: Granulin repeat [57278] (2 proteins)
  6. 3032053Protein N-terminal domain of granulin-1 [57279] (2 species)
  7. 3032054Species Carp (Cyprinus carpio) [TaxId:7962] [57280] (3 PDB entries)
  8. 3032057Domain d1qgma_: 1qgm A: [44380]

Details for d1qgma_

PDB Entry: 1qgm (more details)

PDB Description: the solution structure of a 30 residue amino-terminal domain of the carp granulin-1 protein.
PDB Compounds: (A:) protein (amino-terminal carp granulin-1)

SCOPe Domain Sequences for d1qgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgma_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Carp (Cyprinus carpio) [TaxId: 7962]}
vihcdaaticpdgttcslspygvwycspfs

SCOPe Domain Coordinates for d1qgma_:

Click to download the PDB-style file with coordinates for d1qgma_.
(The format of our PDB-style files is described here.)

Timeline for d1qgma_: